SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060DJR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060DJR2
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.22e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060DJR2
Sequence length 101
Comment (tr|A0A060DJR2|A0A060DJR2_AZOBR) Anti-sigma-factor antagonist {ECO:0000313|EMBL:AIB10909.1} KW=Complete proteome OX=192 OS=Azospirillum brasilense. GN=ABAZ39_02520 OC=Rhodospirillaceae; Azospirillum.
Sequence
MDFSVREAPASTEIVLSGRMTFADHDTFRDVIATFERPAGHRVVFDLSRLDFVDSSGLGM
FIIARDTAQRRNLDFAIRGARDEVRRLITIAKFHTMFNIAD
Download sequence
Identical sequences A0A060DJR2 G8AFU5
gi|392383263|ref|YP_005032460.1| WP_014241288.1.1190 WP_014241288.1.16791 WP_014241288.1.59545 WP_014241288.1.72791 WP_014241288.1.8123 WP_014241288.1.92223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]