SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060DM35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060DM35
Domain Number 1 Region: 25-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060DM35
Sequence length 125
Comment (tr|A0A060DM35|A0A060DM35_AZOBR) Uncharacterized protein {ECO:0000313|EMBL:AIB12113.1} KW=Complete proteome OX=192 OS=Azospirillum brasilense. GN=ABAZ39_08890 OC=Rhodospirillaceae; Azospirillum.
Sequence
MRPTPSHSTVSLHPFATAQGGYGLRAVLSGRVDHAALPGLTPLLRRVAEARAVTLCVDLG
RVEFLDSCGIGILLALRNAVLDHGGAIAFENHPPRIRRVLERSRIVALTDSPRIIDGGLA
LPAAA
Download sequence
Identical sequences A0A060DM35
WP_051657882.1.72791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]