SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060KT43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060KT43
Domain Number 1 Region: 2-43
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000942
Family SPO1678-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060KT43
Sequence length 50
Comment (tr|A0A060KT43|A0A060KT43_VIBCL) Integrase {ECO:0000313|EMBL:AIC64201.1} OX=666 OS=Vibrio cholerae. GN= OC=Vibrionaceae; Vibrio.
Sequence
MTTRTRRTFSAEFRLEAAQLVLDQNYTVVEAAKAMGVDKSTIDNRQSTSG
Download sequence
Identical sequences A0A060KT43
gi|379740372|ref|YP_005332341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]