SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060LYS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060LYS2
Domain Number 1 Region: 162-271
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.08e-17
Family Anti-sigma factor antagonist SpoIIaa 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060LYS2
Sequence length 279
Comment (tr|A0A060LYS2|A0A060LYS2_9BACI) Anti-sigma factor antagonist {ECO:0000313|EMBL:AIC92949.1} KW=Complete proteome; Reference proteome OX=1246626 OS=Bacillus lehensis G1. GN=BleG1_0341 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSLYEFLKENTWNLTEQWYADLDKTKDGVYGSNDPVKIERLKKQNYAFHELFCELFREDY
NAEHTKAFEQWILSIAKDQAHLATPIPEIIEEFLNVQDQYIQLIKDYIEETNEQVSFDQY
DQWIDILVTGFKEIVIAFSRNNMEYADQQLRAQQEMITELSSPVIKLRRTIALLPLVGEI
DTHRAQVIFTQTLEECVSTDIHSLLIDLSGVPVVDTMVANQLFSLIDGLKLVGTKASLSG
VRPEIAQTSVQLGIDFSTTKIYSTIEQALDELLHAVPHY
Download sequence
Identical sequences A0A060LYS2
WP_038476453.1.24056 WP_038476453.1.57412 WP_038476453.1.72531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]