SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060NBD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060NBD4
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily P40 nucleoprotein 0.000000000000034
Family P40 nucleoprotein 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060NBD4
Sequence length 54
Comment (tr|A0A060NBD4|A0A060NBD4_9MONO) Nucleoprotein {ECO:0000313|EMBL:BAO58155.1} OX=1548715 OS=Parrot bornavirus 2. GN= OC=Mononegavirales; Bornaviridae; Bornavirus.
Sequence
TLTIPAVALEIKEFLDVTTKLKAEHGDMFKYLGAIRHSDAIKLAPRNFPNLASA
Download sequence
Identical sequences A0A060N7W7 A0A060N7X3 A0A060N7X6 A0A060N7X8 A0A060N9M4 A0A060N9M6 A0A060N9P1 A0A060N9P2 A0A060N9P6 A0A060NA52 A0A060NA61 A0A060NA64 A0A060NA67 A0A060NA68 A0A060NBC5 A0A060NBC7 A0A060NBC9 A0A060NBD4 A0A060NBD6 A0A060NBD8 A0A060NBE0 A0A060NBE2 A0A060NBT9 A0A060NBU1 M1VMJ2 M1VMJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]