SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Q7S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Q7S4
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.49e-31
Family Ribosomal L11/L12e N-terminal domain 0.0000356
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.49e-21
Family Ribosomal protein L11, C-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Q7S4
Sequence length 144
Comment (tr|A0A060Q7S4|A0A060Q7S4_9PROT) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome; Reference proteome OX=1343158 OS=Saccharibacter sp. AM169. GN=SACS_0016 OC=Acetobacteraceae; Saccharibacter.
Sequence
MAKKVVGYIKLQIPAGKANPSPPVGPALGQRGLNIMQFCKEFNAKTQGLEPGMPIPVVIT
AYADRTFTFITKTPPNTYFLLKAAKITKGSQTVGRASSVGSVTTSQLREIAEKKFQDMNA
NDIDGAVRMLAGSARSIGLDVVEG
Download sequence
Identical sequences A0A060Q7S4
WP_043557819.1.34298 WP_043557819.1.38780 WP_043557819.1.39784 WP_043557819.1.64071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]