SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060S351 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060S351
Domain Number 1 Region: 711-899
Classification Level Classification E-value
Superfamily MIR domain 5.36e-60
Family MIR domain 0.00098
Further Details:      
 
Domain Number 2 Region: 71-298
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.58e-49
Family Fibrillarin homologue 0.00000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060S351
Sequence length 1125
Comment (tr|A0A060S351|A0A060S351_PYCCI) Glycosyltransferase Family 39 protein {ECO:0000313|EMBL:CDO68626.1} KW=Complete proteome; Reference proteome OX=5643 OS=cinnabarina). GN=BN946_scf184996.g57 OC=Agaricomycetes; Polyporales; Polyporaceae; Trametes.
Sequence
MAILAKRLGANVPFGLDPDRCLRRTWRFWWTRWRRPWWWRGAXXXXXXXXXXRGGRGGAR
GGAKGGSNVIVKPHRHKGVFIAEGKESLLVTKNLVPGEAVYGEKRISVDGGVEGTKVEYR
VWNPFRSKLAAGILGGLDDIFIEPGKKVLYLGAASGTSVSHVADIVGPEGVVYAVEFSLR
SGRDLIGMAKKRTNVIPIVEDARTPHRYRMLLSTVDVIFADVAQPDQARIVTHNAEYFLK
DGGHVVISIKASCIDSTAPPTAVFAREVDVLRENKFDPIEQVTLEPYERDHAMVTAVYRR
HELMKPSQLALDLGPPYDDDPASSSDFEEIPHPAAHNAYWSQSSTNHPARHEELPLHYMS
EEKARRRVPRGPGAAGGGFASHFSEKDSDYDAYDDEGKDVYSKMKATKGGPISSGRPRRP
PPPPPTTLREFFQQNLEHIPPIIYTLLSCYTRFHKIGKSNVVVWDEAHFGKFGSHYLKRE
FYFDVHPPLGKMLVGLTGLLAGYDGSFDFSSGATYPENVPYVAMRVMMAIFGVAMVPLGW
YTAVELGMSWMACHLVALMVLCDVAWLCISRFILLDSMLLFFTFTTVFCMAKFHNQQYRP
FTVDWWVWLALTGWSIGCVCSVKWVGLFVTCLVGAYTIEDLWEKFGDLRMSVREQLWHWG
ARVACLIVLPAIIYMSSFKLHFLILNHSGPGDAQMSSLFQANLVGNTFHQNPLDVAIGSK
VTLKNMGWGGGLLHSHVQTYPVGSEQQQVTCYHYKDENNDWVLLPRWDEPPYNPEGPIRF
LKDGDIIRLQHAPTTRNLHSHPIPAPVTKLNNEVSCYGNATIGDYQDYWVVEVVDDIHRG
KKDKYDRIHSLTTRLRFRHHASGCYLRAANAILPQWGFKQIEVSCDKENNPKDIHTYWNV
ESHWNDRLPPGEARYYRSPFLRDFWHLNVAMATSNNALVPDPDKEDILASKPLDWPLLRV
GLRMCGWGDNQTKYYLIGTPVIWWGGTISLVVGSLAALVYLMRQQRKYQDMEPREWEHFL
YVGKVALVGWLLHFVPFLIMGRVTYIHHYLPTLYFSVLMLAHVLDHFVFSSRRISTRTKQ
IVFSLCVVTIVGTFWWFRGVAWGIDGPINDHWGLKWRSTWNIYNE
Download sequence
Identical sequences A0A060S351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]