SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060T9J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060T9J0
Domain Number 1 Region: 38-106
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 4.32e-17
Family F1F0 ATP synthase subunit C 0.0063
Further Details:      
 
Domain Number 2 Region: 122-190
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000000000000106
Family F1F0 ATP synthase subunit C 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060T9J0
Sequence length 197
Comment (tr|A0A060T9J0|A0A060T9J0_BLAAD) ARAD1C38280p {ECO:0000313|EMBL:CDP35557.1} OX=409370 OS=Blastobotrys adeninivorans (Yeast) (Arxula adeninivorans). GN=GNLVRS02_ARAD1C38280g OC=Saccharomycetes; Saccharomycetales; Trichomonascaceae; Blastobotrys.
Sequence
MYKSVGGLALSGLLLVGGYQLFTGQGESFNFGQFLSTTSPQMWATLGIALCIGLSVVGAA
WGIFITGSSILGAGVKAPRITTKNLISIIFCEVVAIYGLIMAIVFSAKLTYVSGPGLYTK
ENMYTGFALFWAGLTVGVSNLICGVAVGITGSTAAIADAADSALFVKILVIEIFGSVLGL
FGLIVGLLMAGKAAEFQ
Download sequence
Identical sequences A0A060T9J0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]