SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060UII4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060UII4
Domain Number 1 Region: 27-110
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.94e-32
Family MHC antigen-recognition domain 0.0000082
Further Details:      
 
Domain Number 2 Region: 113-207
Classification Level Classification E-value
Superfamily Immunoglobulin 6.94e-24
Family C1 set domains (antibody constant domain-like) 0.00000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060UII4
Sequence length 255
Comment (tr|A0A060UII4|A0A060UII4_MACMU) MHC class II antigen {ECO:0000313|EMBL:CDP90144.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=Mamu-DQA1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MILNKALLLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEEFYV
DLERKETVWQLPLFSKFRSFDPQGALRNLAVGKHNLNILIKHSNSTAATNEVPEVTVFSK
SPVTLGHPNTLICLVDNIFPPVVNITWLSNGRSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSMGLVGIVVGTVLII
RGLRSVGASRHQGPL
Download sequence
Identical sequences A0A060UII4 W0ZF12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]