SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060UIX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060UIX5
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000491
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060UIX5
Sequence length 105
Comment (tr|A0A060UIX5|A0A060UIX5_9PROT) Uncharacterized protein {ECO:0000313|EMBL:CDQ08667.1} KW=Complete proteome OX=160808 OS=Acidithiobacillus ferrivorans. GN=AFERRI_100102 OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MSTATFWERRMVDGAPRLFLQGDWRVAQLDKALRSFAWAKDGQDCTEISVAELEAADSAT
LAVLMEWTQQATERGIVLRIRGASSNLQELASLYHLQDILPLYHD
Download sequence
Identical sequences A0A060UIX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]