SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060UWD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060UWD2
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily DsrEFH-like 0.000000000155
Family DsrEF-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060UWD2
Sequence length 121
Comment (tr|A0A060UWD2|A0A060UWD2_9PROT) Uncharacterized protein {ECO:0000313|EMBL:CDQ11048.1} KW=Complete proteome OX=160808 OS=Acidithiobacillus ferrivorans. GN=AFERRI_50013 OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MKQLIILVTTLNMEDLVAITDIFDGARAASDDYHVEIILTGESGIIATLQAAENGLDVKL
MYSIYESMRTAKSSGVKINICERSIEWCNLNNNKLIPEIDNIVSSQYIMERSTPDTYVVY
L
Download sequence
Identical sequences A0A060UWD2
WP_035193918.1.7011 WP_035193918.1.89598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]