SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060W3I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060W3I0
Domain Number 1 Region: 402-566
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.01e-57
Family IP3 receptor type 1 binding core, domain 2 0.0000000581
Further Details:      
 
Domain Number 2 Region: 236-399
Classification Level Classification E-value
Superfamily MIR domain 5.23e-50
Family MIR domain 0.000000247
Further Details:      
 
Domain Number 3 Region: 1087-1243
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.01e-34
Family IP3 receptor type 1 binding core, domain 2 0.0075
Further Details:      
 
Domain Number 4 Region: 107-219
Classification Level Classification E-value
Superfamily MIR domain 1.44e-19
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1197-1285,1381-1649,1933-2020
Classification Level Classification E-value
Superfamily ARM repeat 0.0000592
Family MIF4G domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060W3I0
Sequence length 2062
Comment (tr|A0A060W3I0|A0A060W3I0_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ61667.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00065595001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MSDKMSSFLHIGDICSLYAEGSTSGFISTLGLVDDRCVVQPDTGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHHAADLEKKQNESENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSLGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKVVLFMKWSDNKEIILKGGDVV
RLFHAEQEKFLTCDDFKKKEYVFLRTTGRQSATSATSSKALWEVEVVHHDPCRGGAGYWN
SLFRFKHLATGSYLAAEVNPDYVEECPEPRSSVVDFVPFNFQVLCLSLNSFVRLRHLCTN
TWVHSTNNPIDKEEEKPVMLRIGTSAVKEDKEAFAIVPVPPAEVRDLDLANDASKVLASI
AGKLERGTITQNERRFVTKLLEDLVFFVCDIPNTGQDVLEIMVNKPNRERQKLMREQNIL
KQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAK
QFRFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVTLVRKNREPRFLDYLSD
LCVSMNKSIPVTQELICNAVLDPSNADILIETKLVLSRFEIEAVTIGEAPVETEEDEEEV
WLFWRDNLKEIRSKSVRELAQDAKEGQKEDQEVVSYYRYQLNLFARMCLDRQYLAINKIS
GQLDVDLILRCMSDEDLPYDLRASFCRMMLHMHVDRDPQEQVTPVKYARLWSEIPSKIAI
GDYDNDGTTRDEIKERFCLTMEFVENYLMSVVSQNIPFDDREKNKLTFEVVNLARNLIYF
GFYNFSDLLRLTKILLNILDCVHVSTIYPVTKLEKGEEKQGSNVMKSIHGVGELMTQVVL
RGGGFLPVTPTHQPEEGVVKTQTEPEREDIMVMDTKLKIIEILQFILNVRLDYRISCLLC
IFKREFDESNPQGDGTASSASQDGNNMTGALDFENIEEQAEAIFGGSEENTPLDLDDHGG
RTFLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKS
DLDQLRSIVEKSELWVYKRQGDDDGGDGPSESDHKNKGDSGSSDKKKTETTSSYNYRVMK
EILLRLSKLCVQEGASGKKSKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVRMQEIMKLA
HEFLQNFCAGNQQNQILLHKHINLFLNPGILEAITMQHIFMNNFQLCSEINERVVQHFVH
CTETHGRHVQYLKFLQTIVKAENKFIKKCQDTVMAELVNSGEDVLVFYNDRASFQTLVTM
MRSERDRMDENSALRYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPE
VKIAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTVLEGY
VTETVMSIVTTFFSSPFSDQSTSLQTRQPVFVQLLQGVFRVFHCNWLTPTQKASVEACIK
VLSDVAKSRAIAIPVDLDSQVNNLFVKSNNVVTKSILSWRLSAKNAPRRDSNATTSVSYR
NIIERLQDIVSALEDRLHPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFISKLIK
HTKQLLEENEERLCIKVLQTLREMMTKDRGYGEKHIAFDDEMDVAEGRSTGHFHSIHLLT
ELDPNQPEKQLEDQRRGEALRQILVNRYYGNIKPGARRDSVTTFINGPVPPGTEGKPRAV
VSSGAAAARGELTLHEVQCRLDKEGASDLVIDLIMNATSDRIFQESILLAIALLEGGNTV
IQKSFFMRLTGENKSEMFFKVFYERMKLAQQEIKATVTVNTSDLGSKKKDEEPPDKDTPT
AKGKKGKVVATVAVAAVTEEVKEQLVEASTVTKKAFTTYRREAEAEEHLATAECQGPAST
PDDQEGEMSVIITIMQPILRLMQLLCENHNRELQNFLRCQNNKNNYNLVCETLQFLDCIC
GSTTGGLGLLGLYINEKNVGLINQTVESLTEYCQGPCHENQNCIATHECNGIDIIIALIL
NDINPLGKKRMDLVLELKVVLV
Download sequence
Identical sequences A0A060W3I0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]