SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060W753 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060W753
Domain Number 1 Region: 30-127
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-23
Family SH2 domain 0.0000897
Further Details:      
 
Domain Number 2 Region: 148-194
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000183
Family SOCS box-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060W753
Sequence length 195
Comment (tr|A0A060W753|A0A060W753_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ60385.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00081701001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MQQDHGERGGSCQNPAAPLYDSTEDLCSITNTFQYLQNSGWYWGSISASEARDALLKMSA
GTFLVRDSSHPLYMLTLSVKTAFGPTNVRIEYIGGRFRLDSSSPGPPHLLSFPDVCSLVQ
HYVEDTPQPKAKPRSPQPAVKGNAVLLKLLRPLPQAFPSLQHLTRLTINHHTDCPYQLPL
PCPLVRYLQDYPFQV
Download sequence
Identical sequences A0A060W753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]