SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WCT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WCT6
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000582
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060WCT6
Sequence length 190
Comment (tr|A0A060WCT6|A0A060WCT6_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ63049.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00068290001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MSVDWSYRPQSGGPPQAFFHFSSLVFPPRDGQFNGRVKWLGSPARGEASIQLLNASLSDN
GTYTCSVRNPPDVHGFPTSQTVLTVTPEVLAVHFSDVAVLLAFILLPSTIITLALLGRMC
CPPRDKSQTQGYHSPIEVTPGEEPGFKQIHSKEKNMTCCHVYLLDSDYEDYYVHKERPPV
QGETMAESQC
Download sequence
Identical sequences A0A060WCT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]