SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060WLK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WLK2
Domain Number 1 Region: 392-529
Classification Level Classification E-value
Superfamily MIR domain 4.71e-36
Family MIR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060WLK2
Sequence length 558
Comment (tr|A0A060WLK2|A0A060WLK2_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ65969.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00074384001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MIIIQVYLMQHCLNAVLIIDTDNEVTRKHWLMHATSERGHRLQCSRPSSRLPIYGLTDGK
PCWHRNVETFRNSAKLKLMLTTGHTGAMLTSIKLPIVIRAEINLVLVVVTALGLLSRLYG
INFPKAVVFDEVYYGQFVSLYTKQVFFIDESGPPLGHMILAFGAYLGGFDGNFIWNRIGA
EYSSNVPVWSLRLIPALAGSLCVPLCYLLVVELGYSHLTALGAALLFLMENSLIVQSRFM
LLESVLIFFLLLAVVSYLRFHNAQSGSPVRLAWLVLTGVTCACAVGVKYMGLFTYFLLLG
LAAVHTWQLIGDRALSNVSSLGLFFCLPTVQGVVLMQVVTRFLALVVLPLLLYLGFFYVH
LNLLYRSGPHDQMMSSAFQASLEGGLARITQGQPLEVAYGSQVTLRSVSSKPIPCWLHSH
KANYPIRYENGRGSSHQQQVTCYPFKDVNNWWIIKDPGRQDLVVSSPPRPVRHGDVVQLL
HGMTSRLLNTHDVAAPMSPHAQEVSGYIDFNVSMPAQNLWKVVRHTHAHTHTLPPPHTAP
FLFPDRMGPWTCAAYAKS
Download sequence
Identical sequences A0A060WLK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]