SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060WZC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WZC7
Domain Number 1 Region: 21-169
Classification Level Classification E-value
Superfamily MIR domain 1.01e-38
Family MIR domain 0.005
Further Details:      
 
Domain Number 2 Region: 858-972
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-16
Family SPRY domain 0.053
Further Details:      
 
Domain Number 3 Region: 210-328
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000549
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 
Domain Number 4 Region: 3816-3894
Classification Level Classification E-value
Superfamily EF-hand 0.000000618
Family Calmodulin-like 0.071
Further Details:      
 
Domain Number 5 Region: 438-573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000253
Family Glycosyl hydrolases family 16 0.059
Further Details:      
 
Domain Number 6 Region: 1197-1318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000375
Family SPRY domain 0.026
Further Details:      
 
Domain Number 7 Region: 1940-2010
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000301
Family IP3 receptor type 1 binding core, domain 2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060WZC7
Sequence length 4791
Comment (tr|A0A060WZC7|A0A060WZC7_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ69955.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00004066001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MAEGGDGEEEIQFLRTPISVFRIAHYEGGAVCSHARSLWRLEPLRIGWSGGHMKWGQSFR
VRHITTGRYLCLDEEKGLLVVDPEKANAKMSAFCFRISKEKIEVAQKRDVEGMGTPEIKY
GESMCFVQHVSSGLWLTYASVDAKSARLGPLKRKAILHKEGHMDDALTVARSQTEEFQAA
RMIYNTAGLFTQFIKALDSLSGKNKSSSGPPSLPMDSVALSLQDLIFYFRPPEEELEHEE
KQTKLRSLKNRQNLFQEEGMITLVLDCIDRLNVYNTAAHFSEFAGEEAAESWKEIVNLLY
ELLASLIRGNRANCALFCDNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHI
KSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQNLITENLLPGRDLLLQSNIINYVTS
VRPNIFLGTCEGSTQYKKWYFEVMVDYVEPFLTAQAFHLRVGWALTEGYSPYPGGGEGWG
GNGVGDDLYSYAFDGLHLWSGRVLRHVASPNMHILAADDVVSCCLDLSVPSISFRINGHP
VQGMFENFNLDGLFFPVVSFSAGVRVRFLLGGRHGDFKFLPPPGYAPCYEAVLPKDRLRI
EPIKEYKHDFNGVRNLLGPTQSLSHTAFTPCPVDTVQIVLPPHLERIREKLAENSHELWA
ATRIEQGWTYGSFRDDNKKLHPCLVDFQSLPEPEKNYNLAMSGETLKTLLALGCHVGMGD
EKAEENLKNIKMPKTYMMSSGYKPAPLDLNHVKLTPNQTNLVERLAENGHNVWARDRVHQ
GWTYSIVQDIMSKRNPRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGN
GEGHSRGNKIRVFRAEKSYAVTQGKWYFEFEAVTVGDMRVGWARPSVRADTELGADELAY
VFNGFKAQRWHVGNEPFGRSWLPGDVVGCMIDLVEQNIFFTLNGEMLISDSGSEMAFKDI
DTGDGFIPVCSLGLSQVGRLNLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSL
PQFIPVPTEHPHIEVSRVDGTVDSAPCLKLTHKTFGSQNANTDLLFLRLSMPVEFHETFK
VMAGTTPLTRALTIPEDEVLEVDPDSDFEVLKKSASRTEKEEEKKEPSVPKEIPVNEGGE
NVKDASTEKSKKKGFLFKAKKAAFTPPPVVPTMPRLMEEVVPDDRDDDDIILNTTTYYYS
VRVIAGQEPSGVWVGWITPDYHQYDLHFDLSKVRNVTVTVGDDKGNIHDSMKRSNCYMVW
GGEFSSSQQTRVSQEDFVIGCLIDLDTGLMTFTANGKEINTFYQVEPNTKLFPAVFVLPS
SQNMLQVELGKLKNIMPISAAMFRSERKNPVPQCPPRLDVQMLTPVIWSRMPNHFLSPET
GRVNERHGWMVECREPLTMMALHIPEENRCIDVLELSERMDLLKFHYHTLKLYGSVCALG
NNRVAHALCSHVDESQLFYAIENTYLPGPMRSGYYDLLISMHLESAKRNRLMTNKEFIVP
MTDETRSINLYSDTDNSHALPGVGLTTCLRPKLHFSPTGFVGTDLDIYTLSPFIPLQVLK
AKALTMLTEAVQDGGQAMRDPVGGSVEFHFVPILKLISTLLIMGVFENEDVKHILKMIEP
TVFNEELEAELEELDGEKVDGEKGAEETEKEATPGEADGEAEEQVGLEEGLLHMKLPESV
KLQMCTLLQYFCDCELRHRVEAIIAFSDQFVSQVQANQRARYNELMLAFTMSAAETARKT
REFRSPPQEQVNMLMNFKSIAEDEECPVPDEVRDALLSFHKNLLAHCGVHIEEEEVEEEL
DMSLKGRLFRILDKLRHLRKKKVEEAPEPVEETKPSTLQELISHTMIHWAQESFIQNPEL
VRLMFSLLHRQYDGLGELIRALPKAYTINAISIKDTMDLLECLGQIRSLLIVQMGPEEER
LMIQSIGNIMSNKVFYQHPNLMRALGMHETVMEVMVNVLGGGDSKEIRFPRMVTNCCRFL
CYFCRISRQNQRSMFDHLSYLLQNSGIGLGMRGSTPLDVAAASCIDNNELALALQEQDLE
KVVKYLAGCGLQSCPQLLAKGYPDIGWNPCGGEKYLDFLRFAVFVNGESVEENANVVVRL
LIRRPECFGPALRGEGGNGLLAAIEEAIKISEDPARDGPTVKKDRRFPGMFPGGEEQHEE
NKVHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPMEDLVGVISLS
VQIPDFGKDNSVIEPKMSSSFVPDHKAPMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAA
ASLDTAAFCTTEMALALNRYLSLAVLPLITKCAFLFAGTDHRAIMIDSMLHTIYRLSRGR
AFTKAQRDVIEECLMALCKNLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWK
YYCLPNGWGNFGVSSEEELHLTRKLFWGIFESLAHKKFDAELFKIAMPCICAIAGAIPPD
YVDASYSSKTEKKALVDAEGNFDPKPVETTNTIIPERLDGFINRYAEYTHDKWAFEKIQN
NWTYGEMLDENSKTHPMLRPYKTFSEKDKEIYRWPIKESMKAMIAWEWTLDQTREGDEAK
TEQKKAARKISQTAQATYDPSHGYSPQPIEISHTALSRELQSMAEQLAENYHNTWGRKKK
MELQSKGGGAHPLLVPYDTLTAKEKARDREKAHELLKFLQLNGFAVTRGMKDMESDISSI
EKRFAYGFLQKLLKWMEIAQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFK
NHCLYFLSTPAKVLGSGGHSSNKEKEMIASIFCKMAALVRHRVSLFGNDAAAIVNCLHIL
ARSLDARTVMKSGPEIVKAGLRSFFEGAADDIEKMVENLKLGKVSKGNQQVKGVSQNINY
TTIALLPVLTSLFDHISQHQFGDDVMLDDLQMSCYRIMCAIYSLGSVKNPHVERQRPALG
ECLAHLAAAMPVAYLEPHLNEYNAFSVYTTKSPRERAILGLPNEVQELCQDIPELDVLLK
EIGDLAESGARYTEMPHVIEITLPMLCNYLPRWWERGLENFPELEGQICTDVTSDQLNQL
LGSIMKIVVNNLGIDEASWMKRLAVFSQPIVSRARPEMLKSHFIPTMEKLKKRTGKVVAE
EDHLRMEGKAEGDEEEGTIRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDAEELF
RMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKAGGSDVERTKKKRRG
DRYSVQTSLIVAALKKMLPIGLNMCSPADHELINLAKIRYSLRDTDEEVREFLQNNLHLQ
GKVENPSMRWQMSLYKEMAGKAEDADAPEKVVKRVQEVSAVLYHIEVTEHPFKSKKMVWH
KLLSKQRRKAVVACFRMTPLYNLPRHRASNMFLEGYKRNWIHTEGYSFEDRMIDDLSKAM
EQEGEEEEETETKPDPLHQLILHFSRTALTEKSKLDTDYLYMAYADIMAKSCHIGEEDEG
GEEVEEGAEDEMSFEVRQTELEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGCM
VSSTLKLGISILNGGNVEVQQKMLEYLKDKKDVGFFLSVQALMQTCSVLDLNAFERQNKA
EGLGMVSEEGTSKSFFPLECLTADLLKLRSSPLLRLIRIPEHGISAISQSIDLSNSPLVK
LLNCVVCLYTVMSIVPIHESISDFYWYYSGKDIIDEPGKKNFSKAMTVAKQIFNSLTEYI
QGPCTGNQQSLTHSRLWDAVVGFLHVFAHMMMKLAQHRQNPRGKPGSDSSQIGLLKELLD
LQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFR
DYVTDPRGLISKKDFQKAMDSQKQYSPSEIQFLLSCSEADENDMINFEEFADRFQEPAKD
IGFNIAVLLTNLSEHVPHDLRLKNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEIS
EVNRTQWEMPQVRESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMNIASQISEQEEEK
EEEDDDEPAEGGAEAGGGGGGDEEGNGEEGEPESSSAFADFINSLLNFLSIFTFRNLRRQ
YRRVRKMTIKQIVVGLATFFWTILIGILHFIYSVCKGFFLLIWQTLFGGGLVEGAKNITV
TEILASMPDPTQDEVHGDLPGEPRTGEEQEAGGVTDQMDTGGGEEEEEDKQDKEGGGPPR
IDAPGGLGDMGIEATVEPPTPEGTPLTRRKQQPEEGAAAAADGQAAEPAPAPAPAIEEPP
PEPEKADTENGEKAEKEAETKEEEKQEEPKEKKAKDKKTKKQHREQGFQLWTELDIQRNK
FLNYLSRNFYNLRFLALFIAFALNFILLFYKVSDSPPGEGDEVEGSGMFEGSGEEEEEGP
VYFFLEESTGYMQPTLTFLAALHTVIAFLCIIGYNCLKIPLVIFKREKELARKLEFDGLY
ITEQPEDDDIKGQWDRLVLNTPSFPNNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLAS
LDVSQQTDKKPEEPDNSTLAWCTSIDFKYQIWKCGVVFTDGTFLYLCWYTIMSLLGHYNN
FFYACHLLDIAIGVKDLRTILSSVTHNGKQLMMTLGLLAVVVYLYTVVAFIFFRKFYNKS
EDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDVYELYRVVFDITFFFFVIV
ILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLA
NYMFFLMYLINKDETEHTGQESYVWKMYQERAWDFFPAGDCFRKQYEDQLA
Download sequence
Identical sequences A0A060WZC7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]