SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060X4Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060X4Q6
Domain Number 1 Region: 460-489,612-686
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060X4Q6
Sequence length 714
Comment (tr|A0A060X4Q6|A0A060X4Q6_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ74451.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00036934001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MASQKSICFMLNEIPLRLALQQQGSIQRRMVYNDRSNNDVVRSGLNGYKGEWNNLALGNL
DLKHVPSQLIDSATKHSARVGGVCVRLMPIISQSEEYSSIVDLYNTYIAKGRSLIAKRYR
NSYTGTEELYIPAIPIHTLVSEWNKSLHQFHDMIGYDGLGGRQNQRHRRLTVVSNLLIDI
CRHLPETNIAAVVVTLVALAVLIAVKELNIYYEKKMPVPVPIELITIVVATLISYYCKLH
SLYKVAVIGQIPKGLKAPRSPDVSMWGSVVGDAFVVGIVGYALNISLGKIFGQKHGYNVD
SNQEMVAIGLCNIVGGFFQCHAIAASPSRTLLQDSTGGKTQVVGLISSVLVLIFILQLGS
LFEELPKAVLACIVLVNLKGLFMQFKDIPALWKSNKVDLLVWLVTLVCTILLNLDIGLGA
SIGFSMLTVIFKTQLPRYSILGHVPGTELYLDTDTYEEAKEIPGITIFRSSTTMYYTNAQ
LYLDALQEKSGIDIGMLLMKKKKRDTEEKRKDEQEKNKAKKEAKKNGVNGRLPNNTVHPD
DKRDEEKGSPDLKLNQTAIALVDRPINGQVNWGFEQQGNGFDQDSKTDIHGDDHITQMSS
TGREGEMGRSSVNDTHTIILDLSTANFADTATVKTLKNIFLNYRKIDIDIYLTGCQVCVV
EQLSSAGFFCESIPKSCLFTTIHDAVLHSLRLHGASDVPIIYEYALDLTCTTNM
Download sequence
Identical sequences A0A060X4Q6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]