SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060XQX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060XQX6
Domain Number 1 Region: 224-399
Classification Level Classification E-value
Superfamily MIR domain 1.14e-47
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1124-1239
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.44e-17
Family SPRY domain 0.05
Further Details:      
 
Domain Number 3 Region: 703-839
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000185
Family Glycosyl hydrolases family 16 0.071
Further Details:      
 
Domain Number 4 Region: 484-594
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000157
Family IP3 receptor type 1 binding core, domain 2 0.014
Further Details:      
 
Domain Number 5 Region: 1461-1582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000253
Family SPRY domain 0.026
Further Details:      
 
Domain Number 6 Region: 107-190
Classification Level Classification E-value
Superfamily MIR domain 0.00000405
Family MIR domain 0.023
Further Details:      
 
Domain Number 7 Region: 2195-2265
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000183
Family IP3 receptor type 1 binding core, domain 2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060XQX6
Sequence length 3049
Comment (tr|A0A060XQX6|A0A060XQX6_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ82073.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00062806001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MAEGGDGEEEIQFLRTDDQVVLQCTASILKEQIKLCLSCEGFGNRLCFLETTSNAQNVPP
DLAICCFILEQSLSVRALQEMLANTTELNEAVDLDKWSSQGGGHRTLLYGHAILLKHTHS
SMYLSCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSV
SSERYLHLSYASGELMVDASFMQTLWTMNPVMSGCELAEGFLTGGYVLRLFHGHMDECLA
IPAAEQGDNQRRIAHYEGGAVCSHARSLWRLEPLRIGWSGGHMKWGQSFRVRHITTGRYL
CLDEEKGLMVVDPEKANAKMSAFCFRISKEKVEVVKKRDVEGMGMPEIKYGESMCFVQHV
STGLWLTYASVDAKSARLGPLKRKAILHKEGHMDDALTVARSQTEEFQAARMIYNTAGLF
TQFIKYGPSPLPLRLLPPLTYCYPSGGPDGPALMFDLMVSAVTLWLVLGKNKSSSGSPSL
PMDSVVLSLQDLIFYFQPPEELEHEEKQTRLRSLKNRQNLFQEEGMITLVLDCIDRLNVY
NTAAHFSEFAGEEAAESWKEIVNLLYELLASLIRGNRANCALFCDNLDWLVSKLDRLEAS
SGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSN
QNLITENLLPGRDLLLQSNIINYVTSVRPNIFLGTCGGSTQYKKWYFEVMVDHVKPFLTA
QAFHLRVGWALTDGYSPYPGGGEGWGGNGVGDDLYSYAFDGLHLWSGRVPRHVATPNMHI
LAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFFPVVSFSAGVKVRFLLGGRH
GDFKFLPPPGYAPCYEAVLPKDRLHIEPIKEYKHDVNGVRNLLGPTQSLSHTAFTPCPVD
TAQIVLPPHLERIREKLAENSHELWAVTRIEQGWTYGSFRDDNQKLHPCLVGFQSLPEPE
RNYNLAMSVETLKTLLALGCHVGMGDEKAEENLKNIKMPKTYMMSSGYKPAPLDLNHVKL
TPNQTNLVERLAENGHNVWARDRVHQGWTYSIVQDIMNKRNPRLVPYNLLDEKTKKTNRD
TVCAAVRTLIGYGYNIEPPDQESSGHGEGHSRGDKIRVFRAERSYAVTQGKWYFEFEAVT
VGEMRVGWARPSVRADTELGADELAYVFNGFKAQRWHVGNEPFGRIWLPGDVVGCMIDLV
EQNIFFTLNGKMLISDSGSEMAFKDIDIGDGFIPVCSLGLSQVGRLNLGQNVSSLRYFTI
CGLQEGFEPFAINMKRDITMWFSKSLPQFIPIPTEHPHVDVSRVDGTVDNAPCLKLTHKT
FGSQNANTDLLFLRLSMPVEFHETFKIMAGTTPLTRTLTIPEDQVLEVDPDSDFEVLKKS
ASRTEKEEEKEPSVPKDISVNGGENVKDASTEKSKKKGFLFKAKKAALTSPPVVPTMPRL
TEEVVPDDRDDDDIILNTTTYYYSVRVIAGQEPSGVWVGWITPDYHQYDLHFDLSKVRNV
TVTVGDDKGNIHDSMKRSNCYMVWGGEFSSSQQTRVSQEDFVIGCLIDLDTGLMTFTANG
KEINTFYQVEPNTKLFPAVFVLPSSQNMLQVDLGKLKNIMPISAAMFRSERKNPVPQCPP
RLDVQMLTPVIWSRMPNHFLSPEMGRANDRHGWMVECREPITMMALHIPEENRCIDILEL
SERMDLLKFHYHTLKLYGSVCALGNNRVAHALCSHVDESQLFYAIENTYLPGPMRSGYYD
LLISIHLESAKRNRLMTNKEFIVPMTEETLSINLNSDTDKSHALPGVGLTTCLRPKLHFS
PTGFVGADLDIYTLSPFIPLHVLKAKALTMLTEAVQDGGQAMRDPVGGSVEFHFVPILKL
ISTLLIMGVFDNEDVKHILKMIEPTVFSGEAEAAAQGEGDQTLALKERGLKHGEAEEQVG
LEEGLLHMKLPESVKLQMCTLLQYFCDCELRHRVEAIIAFSDQFVSQLQANQRARYNELM
LAYTMTAAETARKTLEFRSPPQEQVNMLMNLKNIAEDEDCPVPDEVRDALQAFHKNLLFH
CSQSSSYFTLHVVEELDMSLKGRLLRMLDKLRHLRKKKVEEEKPEEENKPSTLQELITHT
MVHWAQESFIQNPELVRLMFSLLHRQYDGLGELIRALPKAYTINAISIKDTMDLLECLGQ
IRSLLIVQMGPEEERLMIQSIGNIMSNKVFYQHPNLMRALGMHETVMEVMVNVLGGGDSK
EIRFPRMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLGMRGSTPLDVAAASCI
DNNELALALQEQDLEKVVKYLAGCGLQSCPQLLAKGYPDIGWNPCGGEKYLDFLRFAVFV
NGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAIEEAIKISEDPARDGPTVKKDR
RFPGMFPGGEGQHEENKVHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILR
SLVPIEDLVGVISLSVQIPDFGKDNSIIEPKMSSSFVPDHKAPMVLFLDRVYGIDNQDFL
LHVLEVGFLPDMRAAASLDTAAFCTTEMALALNRYLSLAVLPLINKCAFLFAGTDHRAIM
IDSMLHTIYRLSRGRAFTKAQRDVIEECLMALCKNLRPSMLQHLLRRLVFDVPILNEYAK
MPLKLLNNHYERCWKYYCLPNGWGNFGVSSEEELHLTRKLFWGIFESLAHKKFDAELFKI
AMPCICAIAGAIPPDYVDASYSSKTEKKASVDAEGNFDPKPVETTNTIIPERLDGFINKY
AEYTHDKWAFEKIQNNWTYGEMLDEDSKTHPMLRPYKTFSEKVRGTDKEIYRWPIKESVK
AIIAWEWTLDQMREGEEAKTEQKKGARKISQTAQATYDPSHGYSPQPIEIPHMALSRELQ
SMAEQLAENYHNTWGRKKKMELQSKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQL
NGFAVTRGIKDMESDISSIEKRFAYGFLQKLLKWMEMAQEFIAHLEAVVSSGRVEKSPHE
QEIKFFAKILLPLINQYFKNHSLYFLSTPAKVLGTGGHSSNKEKEMIAR
Download sequence
Identical sequences A0A060XQX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]