SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060YCY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YCY2
Domain Number 1 Region: 11-95
Classification Level Classification E-value
Superfamily MIR domain 0.000000253
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060YCY2
Sequence length 147
Comment (tr|A0A060YCY2|A0A060YCY2_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ89783.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00027515001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
AAQGGGHRTLLYGHAILLRHSFSGMYLTCLKTSRSLTDKLSFDVGLQEDSIGEACWWTIH
PASKQRSEGEKVRIGDDLILVSVSTERYLRXXTPVKPTHRPLGNQPIHPVKPTHTPLGNQ
RGISLLISQSIIRSSLRLVGCEHITIT
Download sequence
Identical sequences A0A060YCY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]