SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060YET2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YET2
Domain Number 1 Region: 87-251
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.45e-58
Family IP3 receptor type 1 binding core, domain 2 0.000000056
Further Details:      
 
Domain Number 2 Region: 773-938
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.24e-33
Family IP3 receptor type 1 binding core, domain 2 0.0094
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily MIR domain 4.97e-21
Family MIR domain 0.00000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060YET2
Sequence length 1434
Comment (tr|A0A060YET2|A0A060YET2_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ90032.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00024244001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MYQLVSVPDGMDISSIFELDPTTLRGGDSLVPRNSFVRLRHLCTNTWVHSTNNPIDKEEE
KPVMLRIGTSAVKEDKEAFAIVPVPPAEVRDLDLANDASKVLASIAGKLEKGTITQNERR
FVTKLLEDLVFFVCDIPNTGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSG
DGPMLRLEELGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVLA
EDTITALLHNNRKLLEKHITAAEIDTFVTLVRKNREPRFLDYLSDLCVSMNKSIPVTQEL
ICNAVLDPSNADILIETKLVLSRFEIEAVTMGENPIETEEDEEEVWLFWRDNCKEIRSKS
VRELAQDAKEGQKEDQEVVSYYRYQLNLFARMCLDRQYLAINKISGQLDVDLILRCMSDE
DLPYDLRASFCRMMLHMHVDRDPQEQVTPVKYARLWSEIPSKIAIDNYDNDGTTRDEIKE
RFCLTMEFVENYLMSVVSQNIPFDDREKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKIL
LNILDCVHVSTIYPITKLEKGEEKQGSNVMKSIHGVGELMTQVVLRGGGFLPITPTHQPE
EGVVKTQTEPEREDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNPQGDN
TLSSASQDGNNMTGALDFENIEEQAEAIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDY
PPLVSGALQLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSIVEKSELW
VYKRQGDDDGGDGPSESDHKKKVFGQNFPTIIGDSGGSDKKKEESNSSYNYRVMKEILLR
LSKLCVQEGASGKKSKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVRMQEIMKQAHEFLQ
NFCAGNQQNQILLHKHINLFLNPGILEAVTMQHVFMNNFQLCSEINERVVQHFIHCTETH
GRHVQYLKFLQTIVKAENKFIKKCQDTVMAELVNSGEDVLVFYNDRASFQTLVTMMRSER
DRMDENSALRYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAY
INFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTVLEGYVTETV
MSIVTTFFSSPFSDQSTSLQTRQPVFVQLLQGVFRLYHCNWLNPTQKASVEACIKVLSDV
AKSRAIAIPVDLDSQVNNLFVKSNNVVTKSILSWRLSAKNAPRRDSNATASVSYRNIIER
LQDIVSALEDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFISKLIKHTKQL
LEENEERLCIKVLQTLREMMTKDRGYGEKLAPLLAEPEVPAADELDPNQPQKQLEDQRRG
EALRQILVNRYYGNIKPGARRDSVTTFSNGPVPPGTEGKPRAGTCLSLYLCLSG
Download sequence
Identical sequences A0A060YET2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]