SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YL07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YL07
Domain Number 1 Region: 142-223
Classification Level Classification E-value
Superfamily BEACH domain 4.05e-32
Family BEACH domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 67-135
Classification Level Classification E-value
Superfamily PH domain-like 4.49e-19
Family PreBEACH PH-like domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060YL07
Sequence length 236
Comment (tr|A0A060YL07|A0A060YL07_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ92411.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00035025001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MSSLLFLSLPVSSSLFLSFFLLSSSLLFLSSLPLFFHYFLISCLCSPLTLIPFLPLSAPL
PLSSPYHYSPLQILTYTEGLHGKWLFTEIRAVFSRRYLLQNTALEIFMANRTAVMFNFPD
AGTVKKVVQCLPRVGVGTNFGLPQTRRISQASPKQLYKASNMTQRWQRREISNFEYLIFL
NTISGRTYNDLNQYPVFPWVITNYDTEDLDLTLPSNYRDLSKVTHPRTLRKKETPR
Download sequence
Identical sequences A0A060YL07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]