SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z0P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z0P1
Domain Number 1 Region: 48-127
Classification Level Classification E-value
Superfamily E set domains 0.000000373
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 2 Region: 257-335
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000259
Family p120GAP domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060Z0P1
Sequence length 335
Comment (tr|A0A060Z0P1|A0A060Z0P1_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ94845.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00027927001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MNCFAPSLVAEYRPGLDTVKHADEFGFIFNNVQTLLVYNKTIFLYYPNPYFEPLSTNGVL
EQKPGSPIILKGRNLVPHASGGVKLNYTVLIGETPCSVTVSETQLLCEPPNLTGQYKVMV
QVGGLHVSPGSVNILSDSLLTLPAIVSIAAGGGLLLIIVILVLIAYKRKSRENDLTLKRL
QMQMDNLESRVALECKEAFAELQTDINELTSDLDRAGIPHLDYRTYAMRVLFPGIEDHPV
LRELEVSGNGQLSTEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTAL
QGKLEYATDVLKHLLSDLIDKNLESKNHPKLLLRR
Download sequence
Identical sequences A0A060Z0P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]