SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060Z372 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z372
Domain Number 1 Region: 384-414,455-514
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-16
Family Anti-sigma factor antagonist SpoIIaa 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Z372
Sequence length 549
Comment (tr|A0A060Z372|A0A060Z372_ONCMY) Solute carrier family 26 member 2 {ECO:0000256|RuleBase:RU362052} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00048416001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
SSHYSFSVFLEPLLPFCFSRAVTPFLRYSLSVFLEPLLPLCFHSVLMGLLQVGFVSVYLS
DSLLSGFATGASLTILTSQVKYLLGLELPRAQGWGSLVKTWVSLFQNLGQTNLCDLVTSM
VCLAVLVPTKELNDRFKAKLKAPIPFELFVVIAATLASHFGHFEQEYGSKVAGAIPTGFL
PPQLPSWSLIPNVAVDAFSIAIVGFAITVSLSEMFAKKHGYVVDPNQEMYAIGFCNILPS
FFRCFTTSAALTKTLVKESTGCQTQMSGLVTALVLLLVLLVISPLFYSLQRCVLAVIILV
NLRGALLKFTDVPRMWRVNRLDTAIWLVTMATSALINTELGLLVGVMVSAFCVLGRTQRA
QALELGRAGHRELYQDLASYNGLQSQPGVAIFRYEAPIYYANQSLFKKALYRCLGLDPVK
EKARRRKLEKHRRKQEEGGTKGKEKELTTKVFLPNQVNFHSVVIDCSPVLFLDTAGVNAL
KEVYKDYKENGVQVFLAQCNTSVLESLNRGGYYPEKGMGEKERVFFTISDAVLYAQSLSS
QNGDCDTSC
Download sequence
Identical sequences A0A060Z372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]