SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061A8S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061A8S1
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily TrpR-like 0.000000000000732
Family SPO1678-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061A8S1
Sequence length 130
Comment (tr|A0A061A8S1|A0A061A8S1_9MOLU) Trp repressor/replication initiator {ECO:0000313|EMBL:CDR30233.1} KW=Complete proteome; Reference proteome OX=35623 OS=Acholeplasma oculi. GN=Aocu_01600 OC=Acholeplasmataceae; Acholeplasma.
Sequence
MGRPKGVLNKAPSRYWSKEAKYEYVQLILTGQYSTEELGKINNVSSGMISTWVKRFKEGG
IEALENKRKPGNPLSKYMNKKELTPLEALQYENMKLRIENERLKKGYTTEEVKAYQAKRK
SKQNTKSSKT
Download sequence
Identical sequences A0A061A8S1
WP_045748809.1.14764 WP_045748809.1.75498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]