SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061B9H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061B9H0
Domain Number 1 Region: 7-148,281-414
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.49e-55
Family Capz alpha-1 subunit 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061B9H0
Sequence length 421
Comment (tr|A0A061B9H0|A0A061B9H0_RHOTO) RHTO0S12e06326g2_1 {ECO:0000313|EMBL:CDR46565.1} OX=5286 OS=Rhodosporidium toruloides (Yeast) (Rhodotorula gracilis). GN=RHTO0S_12e06326g OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MSDARARLDAASTFLLQSPPGEVNDVLSDLRAILSSSGLSDSQIESGLLPALTKHNAEQF
TVVESEGKKVLVTPASRVEGAGEEEGTERHVQLREGKEFVFDHLKGLASSASPHTSPFDS
ETSTLRTSLDKLLSSYVANHYASGVAAVYTLPDPAYPPPEPAAAPTSEEKAAEPEGTGET
GSIAQDVEGGKEEVADVAADTAEEVEKALPEEGVETVGGEGAAPTGTSAEEAEAKEAEAE
EKGKSAEAVEDDKMDVGTPATAPAEVEEEPPASTTEDAAPELPQPRPSRLFGLYFVGNKY
NPSNYCRTGRWRSTYQLDYAKGTLEGTAQINIHYYEQGNVQLSTTLKSSATLSPSPSPES
VVASIKATESSFQRQLGETYNDLSDASFRGLRRALPKTRSKLDWDKATGMRLGQQIGGGA
Q
Download sequence
Identical sequences A0A061B9H0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]