SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061BE31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061BE31
Domain Number 1 Region: 368-561
Classification Level Classification E-value
Superfamily MIR domain 6.67e-44
Family MIR domain 0.0034
Further Details:      
 
Weak hits

Sequence:  A0A061BE31
Domain Number - Region: 632-674
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0871
Family N-terminal domain of adrenodoxin reductase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061BE31
Sequence length 808
Comment (tr|A0A061BE31|A0A061BE31_RHOTO) RHTO0S16e03422g1_1 {ECO:0000313|EMBL:CDR48201.1} OX=5286 OS=Rhodosporidium toruloides (Yeast) (Rhodotorula gracilis). GN=RHTO0S_16e03422g OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MQATASSQPDRLLLHRSRAAAPSPSPGSDSTTPARAVSPSHDPRLDKRSDDWNADVTGQA
GQAGTQGSGKGYLLDKGAEEEPPSSNRTDYIVLLGVFLLAAVLRFYRIDHPSGVVFDEVH
FGKFASYYLRREFFFDVHPPLAKLLLAFQGWLIGYDGSFEFENIGDSYLDAKVPYVGLRT
LPALLGSAIPAVVYAIMRESGYPRVVGLFSACLVLFDNAHIAQTRLILLDAPMILFMALA
FYAYIRFYKLRYSEFTRPWWTWMTLTGIFLSLTISCKMVGLFAFLAVGSAVVYDLWNILD
VRRGLTIEHVARHFFARVFGLIVVPAIVYLFWFWVHFAVLTKSGTGDEFMSPAFQQTLLD
SPLTALAEEIRYYDTVIIQHKGTKAFLHSHPDRYPLKYDDGRISSAGQQVTAYRFNDTNN
HWIVEPTKEIPASGRGRVVRHHDIITLRHVLTNTTLLTHDVACPTMATNTEFTTWDGQCA
SEEECEAKTLDTHFQLDIDDAHEGQQWMTKSSHFQLVHIPTRVAMWTHTDPLLPDWAFKQ
QEVNGNKNLKDRTTFWAVDEIVRDPTKPDLLRPKKEPRKPTKMNFFRKFFELQVLMLQHN
AGLTDSHPYATSPINWPFLLSGISFWTGGTNERQQVYLIGNVVGWWICIMALSIFVGVLA
ADQLANRRGLTPIPTPMRNRLYNTGGFFLLAWLYHYAPFFTMSRQLFLHHYLPAHLISAL
VAGVVFHFLFCGDTVDYPVSVAGPLTRRRPRTRAKVGKGMKIAFVVVVGLLVANFAFLKP
LTYGTPSLTPEQVNRRRMLSSWTLHYAK
Download sequence
Identical sequences A0A061BE31 M7WT33
XP_016272169.1.102030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]