SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061CXS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061CXS8
Domain Number 1 Region: 13-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061CXS8
Sequence length 102
Comment (tr|A0A061CXS8|A0A061CXS8_PSEPS) Anti-sigma-factor antagonist {ECO:0000313|EMBL:CDR92677.1} KW=Complete proteome OX=330 OS=Pseudomonas pseudoalcaligenes. GN=PPSAL_3450 OC=Pseudomonas oleovorans/pseudoalcaligenes group.
Sequence
MSQASIGERAAGQLQLSGVLDYSTGPLLREQGARLIAASSATRLTLDCSAVEKSSSVGLA
LLLAFMRDARKAGRELTISALPDDMREIAQVSGLLELLPLQA
Download sequence
Identical sequences A0A061CXS8 A0A087F8V0 A0A1H6TN60 A0A225E225 W6R012
WP_003459265.1.17458 WP_003459265.1.19689 WP_003459265.1.21710 WP_003459265.1.57345 WP_003459265.1.65910 WP_003459265.1.95985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]