SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061DXT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061DXT4
Domain Number 1 Region: 26-80
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000844
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061DXT4
Sequence length 103
Comment (tr|A0A061DXT4|A0A061DXT4_THECC) Uncharacterized protein {ECO:0000313|EMBL:EOX97182.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_006276 OC=Theobroma.
Sequence
MAIVSKMIDEGDKKQLTITENFDGEPFPFAAHGGKMRVRDEQGTLWRFTYKVKLTNERVL
SGPWEQFLENNSVRVGDTVAIDNNDRWSSGAAEYKIEVISRGS
Download sequence
Identical sequences A0A061DXT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]