SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061ENC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061ENC0
Domain Number 1 Region: 45-130
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000105
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061ENC0
Sequence length 243
Comment (tr|A0A061ENC0|A0A061ENC0_THECC) PH-response transcription factor pacC/RIM101 isoform 3 {ECO:0000313|EMBL:EOY06336.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_021092 OC=Theobroma.
Sequence
MLGKESGGSTFDLPEEVLQVLPSDPFEQLDVARKITSIALSTRVSLLEAESSSFRLKLAE
KDQQIADLYAQIDSLDASLSETSDKLVKADQQKASLMKDNASLSNTVRKLQRDVSKLEVF
RRTLMQSLQEDEESSIIAKPTPSENDVTLPSRTSSMRSQHFGTGNSLVEDRDTDASRPGM
PHSFLLASQTSSPRLTPPGCQCQAPTVDHRQDALGLMERNSSAKSGAVCLMSSLVPSWPM
LKS
Download sequence
Identical sequences A0A061ENC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]