SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061ENR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061ENR8
Domain Number 1 Region: 17-77
Classification Level Classification E-value
Superfamily DNA-binding domain 1.63e-23
Family GCC-box binding domain 0.0000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061ENR8
Sequence length 137
Comment (tr|A0A061ENR8|A0A061ENR8_THECC) Integrase-type DNA-binding superfamily protein, putative {ECO:0000313|EMBL:EOY06017.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_020869 OC=Theobroma.
Sequence
MEGGSRGKEDKEGGETRYRGVRRRPWGKFAAEIRDSNRHGARVWLGTFNTAEEAARAYDR
AAYSMRGHLAILNFPQEYPMASGGGNANYCSSSSVGSSSSSSSSAMERGKQVFEIEYLDD
KLLEELLENEEKKSKKK
Download sequence
Identical sequences A0A061ENR8
Tc04_g025390 XP_007035091.1.67643 CGD0020405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]