SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061FEM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061FEM1
Domain Number 1 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.73e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00074
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.46e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061FEM1
Sequence length 106
Comment (tr|A0A061FEM1|A0A061FEM1_THECC) Transcription initiation factor IIA subunit 2 {ECO:0000256|PIRNR:PIRNR009415} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_034542 OC=Theobroma.
Sequence
MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMTEALESQVKSKVAIK
GHLHTYRFCDNVWTFILQDAVFKYEDASETVGRVKIVACDSKLLSQ
Download sequence
Identical sequences A0A061FEM1
Tc08_g006230 XP_007018286.1.67643 XP_007018287.1.67643 CGD0029776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]