SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061G1V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061G1V1
Domain Number 1 Region: 74-158
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.83e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000802
Further Details:      
 
Domain Number 2 Region: 141-214
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.35e-25
Family Ribosomal protein L11, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061G1V1
Sequence length 226
Comment (tr|A0A061G1V1|A0A061G1V1_THECC) Plastid ribosomal protein l11 {ECO:0000313|EMBL:EOY23825.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_015598 OC=Theobroma.
Sequence
MASSLSTLHHLSSSLCPRNIDNAKLSSTLFHSPINLSSNPNISLQFLNKKQSPLLSSTPR
FLTVIAMAPPKPGGKAKKVVGSIKLALEAGKATPAPPVGPALGAKGVNIMAFCKDYNART
ADKAGYIIPVEITVYDDRSFTFVLKTPPASVLLLKAAGVEKGSKDPKQEKVGKVTIDQVR
AIATEKLPDLNCTSIESAMRIIAGTAANMGIDVDPPILEPKKKELV
Download sequence
Identical sequences A0A061G1V1
CGD0016530 Tc03_g022540 XP_007039324.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]