SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061GHI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A061GHI5
Domain Number - Region: 41-118
Classification Level Classification E-value
Superfamily MIR domain 0.0654
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061GHI5
Sequence length 135
Comment (tr|A0A061GHI5|A0A061GHI5_THECC) Uncharacterized protein {ECO:0000313|EMBL:EOY28873.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_030351 OC=Theobroma.
Sequence
MGAKTKTKKNQKRQLQSPEKRIIKVPNLTLEDWLLASPGPARMKPDCLNGGELYVFKHFS
TKVHLSSSRAPQAVLFTPTDSFFVDLSSGDASCSSFSRSQSGKLKKKVSFRLPEEADIVV
FYSPAGTFGGDQGSF
Download sequence
Identical sequences A0A061GHI5
CGD0025797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]