SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061GLV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061GLV4
Domain Number 1 Region: 201-270
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-17
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 10-67
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.39e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061GLV4
Sequence length 288
Comment (tr|A0A061GLV4|A0A061GLV4_THECC) Ankyrin repeat and SOCS box protein 9 {ECO:0000313|EMBL:EOY30107.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_037430 OC=Theobroma.
Sequence
MPLEPPVFQEAARCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSNQMALPQFGIYSAVRVC
ADCFNDSSGSGKADPQPSLDGVDSVTDEVSRLNISADMGSKTEATAGHQPVASIPDCKCG
MPLCICESPAPTTDALPLQMKNPSTSVASSNPKSKKTATVPKSKGSTSNSKSSLVFNPGL
VANGTAADKPQMDYDVNGEGLREAIKNGDTAAVKRLLSEGVDANYRDKQGLSLLHLAALF
NRTDIVFALMECGASMDYKNAQGETPLDCAPATLQYKMQMKMKESEQA
Download sequence
Identical sequences A0A061GLV4
CGD0031447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]