SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061HK25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061HK25
Domain Number 1 Region: 331-516
Classification Level Classification E-value
Superfamily MIR domain 3.66e-59
Family MIR domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061HK25
Sequence length 738
Comment (tr|A0A061HK25|A0A061HK25_BLUGR) Uncharacterized protein {ECO:0000313|EMBL:EPQ65416.1} KW=Complete proteome; Reference proteome OX=1268274 OS=Blumeria graminis f. sp. tritici 96224. GN=BGT96224_A20497 OC=Erysiphales; Erysiphaceae; Blumeria.
Sequence
MAVEEATFTSGYGIQTQAIRRRGLLSATEPDEKDNIEEERIKLGKSKSVWHHLDEWEIVI
APTVFTALAFFTRLYKIGLSPIVTWDEAHFGKFGSYYLKREFYFDVHPPLGKMLVGLSGY
LAGYNGSFEFKSGEKYPEELNYTFMRAFNALFGAICIPLAYFTARQLNLKRPAVWLTTLM
VLCDNSYTTIARFILLDSMLLCFTLTTILCWARFHNLRHHSFSLEWFTWLFLTGLSIGCV
CSIKWIGLFCTALVGIYTIEDLWNKFGDIDMPKATAHLAARIYALIVIPLLVYMLSFALH
FNILENSGPGDAQMSSLFQANLRGTSVGKESPIDIAYGSRVTIKNMGYGGGLLHSHVQTY
PEGSNQQQITCYHHKDSNNEWLFYPNRNEPEVDPNSPLKYVADGDMLRLIHFQTGRNLHS
HEIHAPVTKEHREVSCYGNTTVGDDKDHWNLEVVKDVSFSDRSRVRTLTTAFRLKHTILG
CYLRAGTVSLPQWGFKQIEVTCDKANKPRDIYTHWNIEAHWNDKLPPANAKAYKSPFFQD
FIHLNVAMMTSNNALVPDPDKQDDLSSQFWQWPIMSIGLRMCSWDDSIVKYFLLGNPFVY
WASSASLISVGLILAWYLVRWQRGYCELDQDEIDQLHYAAIYPALGWLLHYLPFIAMARV
TYVHHYYPALYFAILNLGFLSDWALRRTRKKIQYTAFAILYTITIGLYIYFMPISWGMIG
PSKNYRYLKWIETWRVAD
Download sequence
Identical sequences A0A061HK25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]