SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061J625 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061J625
Domain Number 1 Region: 20-160
Classification Level Classification E-value
Superfamily Plus3-like 6.67e-25
Family Plus3 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061J625
Sequence length 294
Comment (tr|A0A061J625|A0A061J625_TRYRA) Uncharacterized protein {ECO:0000313|EMBL:ESL08752.1} KW=Complete proteome; Reference proteome OX=429131 OS=Trypanosoma rangeli SC58. GN=TRSC58_03540 OC=Herpetosoma.
Sequence
MSDARQTDYLLDEHTPAPPLEFLLKLQLFRTALVNFIEWKNFEEVVRGCFVRVLLEMRSE
DVRRDNSDHYYIACVKGARRGPKYSGFSADMASTEWHIVIELPPCFRATQNGNVVQLNSI
SNSPFRQSEYQQWVEMTREAGHSFMSMPQLQFRLDLLEEHKQQALTPEPRRKRCGEDPQT
TERRERALHALREQIKAEVVNTHVQMPSISELQLCPLEQLQEVEREMLEMISRVRMTINE
RSKCMVCHRRLCTVICYPCKHQVLCKDCAEHILGKCPAPSCTISVQETFEAYTS
Download sequence
Identical sequences A0A061J625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]