SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061JLJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061JLJ6
Domain Number 1 Region: 716-926
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.97e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0093
Further Details:      
 
Domain Number 2 Region: 45-227
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.41e-20
Family Pyruvate oxidase and decarboxylase Pyr module 0.045
Further Details:      
 
Domain Number 3 Region: 432-619
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000481
Family PFOR PP module 0.04
Further Details:      
 
Domain Number 4 Region: 267-395
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000471
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061JLJ6
Sequence length 1161
Comment (tr|A0A061JLJ6|A0A061JLJ6_PSEST) MFS transporter {ECO:0000313|EMBL:EWC40606.1} KW=Complete proteome OX=1218352 OS=Pseudomonas stutzeri KOS6. GN=B597_014130 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSLAEIRLDDKYRLATGHLYLTGTQALTRLPMLQHQRDQARGLNTGGFISGYRGSPLGGL
DKSLWEARDYLKQHAIHFQPGVNEELAATAVWGSQQTNLFPGAKYDGVFAMWYGKGPGVD
RAGDVFKHANAAGVSPHGGVLLLAGDDHGCKSSTLPHQSEHAFIAASIPVLNPANVQEIL
DYGIIGWELSRYSGCWVALKTIAENVDSSAVVEVDPLRMQTRIPDDFELPEDGVHIRWPD
PPLAQEKRLNLYKIYAARAFARANNLNRVMLDSPNPRLGIITTGKSYLDVRQALDDLGLD
EALCARVGLRVLKVGMSWPLEPVSVHEFAQGLDEILVVEEKRSILEDQLTGQLYNWPVDK
RPRVVGEFDEQGSSLLPNLSELTPAMIARVIAKRLAPIYTSDSIQARLAFLDAKEKALAA
RSYSTVRTPHYCSGCPHNSSTKVPEGSRASAGIGCHYMVQWMDRRTETFTQMGGEGVNWI
GQAPFTDTPHMFQNLGDGTYFHSGSLAVRAAVAAGVNITFKILYNDAVAMTGGQPIDGEL
RVDQLSRQIADEGVKRIALVSDEPDKYPSRDTFAPITSFHHRRELDAVQRELREFKGVSV
IIYDQTCATEKRRRRKRGKLEDPAKRAFINPAVCEGCGDCGEKSNCLAVLPLETELGRKR
EIDQNACNKDFSCVEGFCPSFVTVHGGGLRKPEAVAGGIEAATLPEPRHPSLERPWNVLI
PGVGGSGVTTLGALLGMAAHLEGKGCTVLDQAGLAQKFGPVTTHVRIAARQSDIYAVRIA
AGEADLLLGCDLVVAAGDESLTRLNERISNAVVNSHESATAEFTRNPDAQVPGAAMRQAI
SDAVGADKTHFVDATRLATRLLGDSIATNLFLLGFAYQQGLLPISAEAIEKAIELNGVSA
KLNLQAFRWGRRAVLEREAVEQLARPVEAAGSSLAGPICKTLEEIVDWRVDFLTRYQNAG
LARRYRQRVERVREADSADDLALSKAVARYYFKLLAYKDEYEVARLYSEPEFRQQLEAQF
EGDYRLQFHLAPAWLAKRDPVTGEPRKRELGPWMLNVFGVLAKLRFLRGTPLDPFGYGHD
RRVERQLISEYENTVDELLAQLKPTNYRTAVAIAALPEQIRGYGPVKERSIAKARQQEKL
LRDQLAKGDEVQSVRLFQPAA
Download sequence
Identical sequences A0A061JLJ6
WP_003292266.1.36575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]