SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061NAF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061NAF3
Domain Number 1 Region: 150-253
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061NAF3
Sequence length 272
Comment (tr|A0A061NAF3|A0A061NAF3_9BACL) RsbR, positive regulator of sigma-B {ECO:0000313|EMBL:GAJ99551.1} KW=Complete proteome OX=1460649 OS=Geomicrobium sp. JCM 19055. GN=JCM19055_2556 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Geomicrobium.
Sequence
MRSIVLQHMIDNKDHYIELWRVSFDELLFSRSESTIKPQYIQDEMKEEFVSVIFDTLTMD
RHSRRAAVKRFAERLIHDGWVVSEFIMSLQKLRRIVMNDMSNHYDKEKFVDLSRELEDWL
DEQITDLTTEFAKNHEEVKAIQNVALKELSAPLIPVFDKIVVMPLIGTIDTKRASQIMEN
LLEGIIEHRAQVVLIDITGVPLVDTMVAHHIIRASEAVRLVGAECLLVGIRPEIAQTIVN
LGIDLGNFTTKSTLKKRCRNSVANDTARNYYK
Download sequence
Identical sequences A0A061NAF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]