SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061NFN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061NFN5
Domain Number 1 Region: 121-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.23e-25
Family Flavin-binding PAS domain 0.00075
Further Details:      
 
Domain Number 2 Region: 250-359
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000608
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 
Domain Number 3 Region: 2-50
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000279
Family N-terminal PAS domain of Pas kinase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061NFN5
Sequence length 361
Comment (tr|A0A061NFN5|A0A061NFN5_9BACL) Transcription regulator Bat {ECO:0000313|EMBL:GAK02829.1} KW=Complete proteome OX=1460634 OS=Geomicrobium sp. JCM 19037. GN=JCM19037_1092 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Geomicrobium.
Sequence
MFKSFIDKYKDPVIVVDNTFTIRYSNQSFRDQLHYTVDELQNKALAQVTKSDVSLLLEEP
GAALILVNKHGEALSFTAEITEGEDEHDSLLFIICRRILQEDDMTIVANLQFTDLMTSVL
DHTEVGIVITDPSVDDNPIIYANRGFETLTGYAAEDIIGQNCRFLQGEHTDEADVQKLRR
SLAANQPVYVEMMNYTKSGQAFWNELLINPVYVDSAGKEYFVGVQKDITRRKEAEQRLEE
SLEEIRDLSTPVVPLSEGLAVLPLVGVIHEERWQMMTAQVLEQVNTEGEEQLIIDVSGLH
TFEEDFGTKLASLQSMLTLMGTELIITGIRPNMAQQSVLRGVNTSTFRTFSTVRTALKEL
L
Download sequence
Identical sequences A0A061NFN5
WP_081829065.1.8455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]