SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061QSM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061QSM3
Domain Number 1 Region: 144-172,212-295
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000235
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 
Domain Number 2 Region: 344-386
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000655
Family cAMP-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061QSM3
Sequence length 423
Comment (tr|A0A061QSM3|A0A061QSM3_9CHLO) Sulfate transporter {ECO:0000313|EMBL:JAC61356.1} OX=582737 OS=Tetraselmis sp. GSL018. GN=TSPGSL018_26494 OC=unclassified Tetraselmis.
Sequence
AGFTGSYIFSQTLFNFRWGAWGRAVGAVVASGEILLFLAPVSVNEYIPNFFFGGLMFWFG
VDIAYDWLVVALGKVRLVEYALIWVSFVAVLLLGLEAGIGLGTLLAALQFTWEYARLSSS
CVSAGSALSSQMRTYDQRSVLRALQKNIVVVPLSGYIFFGSALRLSSELKQLAESLSASR
AQAQGSEGAPPAAEGTSQPMHLPKQRTAAEQLRPLAPSFMILDFGSVHGFDASSAQAFSG
VKRKLSALGIDLIVCNVPKHATYITRLLTANRVIAPGSDTPALFESLDDGLRYCEGRVLQ
VAMDAGLCHPPVSEMSLTQALESHLGAPAAADLPPGLDLAAAAAQILPFLGVHELSEGEV
LFQRGEPGDRLYIIQSGEVMCEXRAGAAASALPRVWPGEPPRGHRLLPAAAAVLQGVVQH
RAL
Download sequence
Identical sequences A0A061QSM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]