SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061RE30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061RE30
Domain Number 1 Region: 27-200
Classification Level Classification E-value
Superfamily MIR domain 2.62e-53
Family MIR domain 0.00000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061RE30
Sequence length 215
Comment (tr|A0A061RE30|A0A061RE30_9CHLO) Stromal cell-derived factor 2-like protein {ECO:0000313|EMBL:JAC71177.1} OX=582737 OS=Tetraselmis sp. GSL018. GN=TSPGSL018_2496 OC=unclassified Tetraselmis.
Sequence
MQTKWLLPFLCILFASAAGTLFAKETTEVTCGSVIKLMHDKTKAKLHSHDIAYGSGSGQQ
SVTGFQGGDDANSFWIIRGTKAKPCPQGSLIAKGTPIRLQHHSTRKWLHSHNFKSPLTNN
QEVSCFGSDEQSDEGDLWKVDWDGNAKHWMKDTQVRLQHVPTSVYLSSHDKKFGRPINGQ
TEICGMRKGGKESLWSATEGVYFPQHQDEAEHTEL
Download sequence
Identical sequences A0A061RE30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]