SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061RZS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061RZS6
Domain Number 1 Region: 85-252
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.67e-46
Family PsbP-like 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061RZS6
Sequence length 254
Comment (tr|A0A061RZS6|A0A061RZS6_9CHLO) Photosystem II oxygen-evolving enhancer protein 2 {ECO:0000313|EMBL:JAC76264.1} OX=582737 OS=Tetraselmis sp. GSL018. GN=TSPGSL018_20652 OC=unclassified Tetraselmis.
Sequence
MSAITSAPVAKGAFLGQTSQLRSKSGSQAPLRASLRIRAEADQTSRRAALGLAAGAALLS
QAKPSVAAYGDAANVXXXXRNTSGFVPYAGEGYALLLPSKWNPSTEQDFPNIDLRYEDNF
DAVNNLIVSIKPTDKKSIEDYGAPEKFLPEVTYLLGQQSFEGATKSEGGFAENRVSAASL
LGTETVTDKKGKVYYKYNILARSADGDEGGRHQLISATVSEGNLYVLKVQVGDKRWFKGV
DKEAMGAWNSFIVA
Download sequence
Identical sequences A0A061RZS6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]