SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061SHN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061SHN4
Domain Number 1 Region: 7-67
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00000000000536
Family Capz alpha-1 subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061SHN4
Sequence length 86
Comment (tr|A0A061SHN4|A0A061SHN4_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:JAC82405.1} OX=582737 OS=Tetraselmis sp. GSL018. GN=TSPGSL018_5801 OC=unclassified Tetraselmis.
Sequence
MNRTHFQKFQMVQNLLLQSPPGELEYVCRDLREIVKDDELVAAAAVDVFEKQNEEQMVTV
RVKDSNTRVNRKMELPTANGPMTTPL
Download sequence
Identical sequences A0A061SHN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]