SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062DG35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A062DG35
Domain Number - Region: 37-78
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0628
Family Apolipoprotein 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A062DG35
Sequence length 107
Comment (tr|A0A062DG35|A0A062DG35_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:KCX56560.1} KW=Complete proteome OX=1310625 OS=Acinetobacter baumannii 496487. GN=J524_3146 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MDSKWIEAQRREMEKLISPELIKSRDLARQSYFEHMEKEMADHVSRSIEPLSGKKQSTLV
ELRESIEKLAQKYKQDAHSSSLFGDQDKARVYNCFANQLDLLLKGGA
Download sequence
Identical sequences A0A009QWB1 A0A062DG35 A0A062F269
WP_031960801.1.11924 WP_031960801.1.16760 WP_031960801.1.25588 WP_031960801.1.25810 WP_031960801.1.33871 WP_031960801.1.37007 WP_031960801.1.37212 WP_031960801.1.37695 WP_031960801.1.39799 WP_031960801.1.43380 WP_031960801.1.4426 WP_031960801.1.44538 WP_031960801.1.45307 WP_031960801.1.46209 WP_031960801.1.46224 WP_031960801.1.47475 WP_031960801.1.52644 WP_031960801.1.60371 WP_031960801.1.73820 WP_031960801.1.75667 WP_031960801.1.76216 WP_031960801.1.78361 WP_031960801.1.78988 WP_031960801.1.81468 WP_031960801.1.85101 WP_031960801.1.85865 WP_031960801.1.87156 WP_031960801.1.87717 WP_031960801.1.9 WP_031960801.1.90593 WP_031960801.1.91299 WP_031960801.1.9154 WP_031960801.1.92230 WP_031960801.1.92513 WP_031960801.1.94672 WP_031960801.1.95118 WP_031960801.1.99806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]