SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A062GN61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062GN61
Domain Number 1 Region: 740-980
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 2 Region: 29-205
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000277
Family Pyruvate oxidase and decarboxylase Pyr module 0.066
Further Details:      
 
Domain Number 3 Region: 455-632
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000942
Family Pyruvate oxidase and decarboxylase PP module 0.051
Further Details:      
 
Domain Number 4 Region: 277-355
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000175
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.087
Further Details:      
 
Weak hits

Sequence:  A0A062GN61
Domain Number - Region: 647-703
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0386
Family Short-chain ferredoxins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A062GN61
Sequence length 1160
Comment (tr|A0A062GN61|A0A062GN61_9GAMM) Thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein {ECO:0000313|EMBL:KCX98038.1} KW=Complete proteome OX=1310685 OS=Acinetobacter sp. 72431. GN=J584_1483 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MNIATKVTPNIIATKDVSLEDKYVSDNGTAYMTGIQALVRLPLAQTRRDAMNGYHTAGFI
SGYRGSPVGNYDSFLWQVQGLLKSHDVVFQPGVNEDLAATAIWGTQQVNLSGQGKYDGVS
SWWYGKGPGVDRSGDVLRHANLAGTSERGGVVALFGDDHSCKSSTIPHQSEHVMIGCGIP
IFYPTSVQQILDFGVHAIAVSRFSGLWSSMKLVSEIVETSASVHVDLDRVTPVIPEDVNF
PEGGVNIRWPDHGIQQEERLYKYRLPAVLAYARANKINTVTWPCENARIGIAASGKGYLD
TIEALRILGIEDETAQQLGLRVYQVGMIWPLEPQGVREFAEGLQELIVIEEKRPIIETQI
KDELYSLPDGKRPHVIGKATDGKGEWSTSIEEAPLIGHYEYQPEPIAKMLAARFLKLDIP
ENLKAQIQSRIDLLLKAEQESKRVIDLAERKPYFCSGCPHNSSTVVPEGSRALGGIGCHY
IAVSLDRGTETFSQMGGEGVSWVGASPFTNEKHIFANLGDGTYFHSGYLAIRQSIAAKTN
ITYKILYNDAVAMTGGQHVDGHLSVAQLTRQLAAEGIKKQVIVTDEVKLLNEEDGIAPGV
EIRHRNELDTVQRELREVTGVTALIYVQTCASEKRRRRKRDAYPDPAERLYINSDICEGC
GDCSKKSNCLSIEPVETALGTKRQINQSSCNKDFTCAEGFCPSFVTVHTRDMKRPAKFEG
IGAGWPTSPVIPQLYDVPSRIMVGGIGGTGVVTIGALLGMAAHLEGKATRVMDMAGLAQK
GGTVYSYVQLAASDEQISSTKIPAGQCELLIGADAVVAGGSAALSRLKDDALVIVNEDST
PTSEFIKSRDWYAPISDLIDRLRGRVRQGQLVSLPAARIATQLLGDSIYTNQLLLGMAWQ
SGRIPLLRESIEKAIRLNGTAVEKNLEAFRVGCHLASDPTLAGRLVAAMPKTKTPQTLAE
LVEDRSARLTDYWNEAYAAKYRTLVELAAKKLPEELTGTIATQLYRVMAYKDEYEVARLL
TGKSFKESIETQFGKGLRLTYHLAPPALLGGLKNVRKRAFGYWMRFPMMMLARLQWLRET
FLDPFARQEERQHEQAWRDRYIAFVEALVEAPDNHNLAVAEQIAKLPAEVRGYGHIKMKA
MDAAKQRWDELTPTLLKVRN
Download sequence
Identical sequences A0A009GBT1 A0A009MX59 A0A010UUG8 A0A062DTE5 A0A062GN61 A0A062KYD8 A0A1C2W4J9 K9CGF8
WP_002114166.1.10172 WP_002114166.1.10577 WP_002114166.1.15127 WP_002114166.1.15324 WP_002114166.1.16785 WP_002114166.1.19026 WP_002114166.1.21157 WP_002114166.1.22540 WP_002114166.1.24130 WP_002114166.1.27093 WP_002114166.1.28356 WP_002114166.1.28666 WP_002114166.1.32082 WP_002114166.1.32712 WP_002114166.1.33112 WP_002114166.1.33990 WP_002114166.1.34068 WP_002114166.1.3591 WP_002114166.1.38165 WP_002114166.1.38536 WP_002114166.1.39054 WP_002114166.1.40405 WP_002114166.1.41195 WP_002114166.1.44199 WP_002114166.1.44502 WP_002114166.1.44895 WP_002114166.1.45253 WP_002114166.1.45892 WP_002114166.1.46031 WP_002114166.1.47248 WP_002114166.1.47968 WP_002114166.1.54053 WP_002114166.1.5629 WP_002114166.1.57061 WP_002114166.1.59296 WP_002114166.1.61872 WP_002114166.1.62133 WP_002114166.1.65610 WP_002114166.1.66414 WP_002114166.1.68333 WP_002114166.1.69405 WP_002114166.1.71795 WP_002114166.1.72314 WP_002114166.1.74047 WP_002114166.1.74342 WP_002114166.1.75893 WP_002114166.1.77264 WP_002114166.1.77640 WP_002114166.1.8016 WP_002114166.1.83027 WP_002114166.1.83233 WP_002114166.1.8589 WP_002114166.1.86200 WP_002114166.1.89761 WP_002114166.1.93042 WP_002114166.1.9318 WP_002114166.1.9494 WP_002114166.1.96439 WP_002114166.1.97698 WP_002114166.1.98297 WP_002114166.1.98696 WP_002114166.1.98783 WP_002114166.1.99121 HMPREF0013_00588T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]