SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062I6L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062I6L8
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily TrpR-like 2.35e-19
Family SPO1678-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A062I6L8
Sequence length 142
Comment (tr|A0A062I6L8|A0A062I6L8_ACIBA) Transposase family protein {ECO:0000313|EMBL:KCY14501.1} KW=Complete proteome OX=1310697 OS=Acinetobacter baumannii 21072. GN=J596_3618 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
NYNNHGAEGLSRKNTNTVYTPEFKFKVIQSVLEQGLSVREATNQFNLKSHTQLLSWLLQY
EEHGIDGLKAKPKGRPKSVPKPKIKKVKNALNDRDKTQEQLLEELAYLRAENAYLKKRRA
LIQKQKEQEQAEQQRLQDSFLN
Download sequence
Identical sequences A0A062I6L8
WP_032037540.1.78197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]