SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A062KYN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062KYN7
Domain Number 1 Region: 391-481
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A062KYN7
Sequence length 484
Comment (tr|A0A062KYN7|A0A062KYN7_ACIBA) Sulfate transporter family protein {ECO:0000313|EMBL:KCY49525.1} KW=Complete proteome OX=1310816 OS=Acinetobacter baumannii 1571545. GN=J715_1715 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MLTNLREQWFSNVRADILSGLVVGLALIPEAIAFSIIAGVDPQIGLYASFCIAVIISFVG
GRPAMISAATGAMALVMTTLVKEHGLQYLFAATILTGVIQIIAGYLKLAKLMRFVSKSVV
IGFVNALAILIFMAQLPELINVSWYVYLLVAIGLAIIYLFPYVPKLGKFFPSPLICIVIV
TLLTLFLGIDVRTVGDMGALPNTLPIFLIPNIPLNLDTLLIILPYSLALAAVGLLESMMT
ATIVDEMTDSPSNKFKECKGQGIANIASGFMGGMAGCAMIGQSMINVKSGGRTRLSTLCA
GIFLLILVVFLSDWLKVIPMAALVAVMIMVSISTFEWSSLTQFKTHPKSSNIVMIATVVV
VVATHNLALGVLTGVLLSALFLANKLENDVHVITSLEGNYRLYDLRGQIFFSSSDKFMQS
FNFKEEVKEVIIDLTHSRIWDITSVAMLDSAVERFQKNGIQVTVRGLNEANSVMIDKYGT
HAKI
Download sequence
Identical sequences A0A014AUG1 A0A014BCC6 A0A014DHK3 A0A014DPF4 A0A014DUH8 A0A014E9S7 A0A014EH57 A0A014EUD1 A0A062KYN7 A0A062N6E4 A0A062STU5
WP_017394086.1.100576 WP_017394086.1.16924 WP_017394086.1.17678 WP_017394086.1.21600 WP_017394086.1.21774 WP_017394086.1.29521 WP_017394086.1.31793 WP_017394086.1.370 WP_017394086.1.53546 WP_017394086.1.53558 WP_017394086.1.70478 WP_017394086.1.74078 WP_017394086.1.79917 WP_017394086.1.80429 WP_017394086.1.92445 WP_017394086.1.9755 WP_017394086.1.98939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]