SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A062MWL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062MWL9
Domain Number 1 Region: 3-304
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.77e-109
Family Glutaminase 0.00000244
Further Details:      
 
Domain Number 2 Region: 327-398
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000255
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A062MWL9
Sequence length 440
Comment (tr|A0A062MWL9|A0A062MWL9_ACIBA) Glutaminase {ECO:0000256|HAMAP-Rule:MF_00313, ECO:0000256|SAAS:SAAS00041476} KW=Complete proteome OX=1310709 OS=Acinetobacter baumannii 1288284. GN=J608_0644 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MQTPLPDYLANVIEACDIDNSGHLADYIPELANANPNRLALAMSTVDGEIYSVGDDDVEF
TIQSISKPFVYAYVLQQLGIDAVLAKVGVEPSGEAFNEISLGKDGRPKNPMINSGAITVH
SLIQVKHGLHSAEILRRFMSELAGRELSFDESVYDSEVKTAYRNLSIGYMLRTVGILETD
PVDIVNGYIRQCAIMVTVKDLVRMGSVLANGGVDPKTGKRLLNRSVVRQVLSVMMSCGMY
DAAGDWLSTVGIPAKSGVAGGILGVLPGQVSIAAFSPRLDEHGHSVRGIDILERLSRDMG
LHLMEGTPSAQTIVQSHYRTGKDASLSVYVLRGVLKFTEAEMLLRILQDETTDQSTIVID
LTQISLIHDVGKRMFLEGVDRLIDDGHTLVLVDPEQRLDHARTAKDRELHVYHDFDDLLE
KHEIPAKKKTYSDIAALLNC
Download sequence
Identical sequences A0A062MWL9
WP_001194399.1.75890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]