SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062MY05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062MY05
Domain Number 1 Region: 13-60
Classification Level Classification E-value
Superfamily TrpR-like 0.0000000000141
Family SPO1678-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A062MY05
Sequence length 127
Comment (tr|A0A062MY05|A0A062MY05_9GAMM) Transposase family protein {ECO:0000313|EMBL:KCY72911.1} KW=Complete proteome OX=1310833 OS=Acinetobacter sp. 796380-1375. GN=J732_2645 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MTTNHQTSIASLAKKRRTYSAEFKQQIVQACKAPDVSIASVALQHGLNTNLVSKWIRLID
AKPGNDRSPLPNKPAFIALSCSAPLDPTPTDMLTVQITLPHSKAEIGLKWQVSKISALAE
LLKALAT
Download sequence
Identical sequences A0A014BBH1 A0A014BEI3 A0A014BVP7 A0A014C491 A0A014CJ32 A0A014E9C7 A0A062C0J0 A0A062MY05 A0A062SKS8 A0A1J6Y9B4 N9GBZ1 N9H703 N9PC88
WP_005094709.1.100576 WP_005094709.1.1813 WP_005094709.1.21600 WP_005094709.1.28245 WP_005094709.1.31793 WP_005094709.1.53546 WP_005094709.1.63212 WP_005094709.1.7194 WP_005094709.1.7362 WP_005094709.1.77517 WP_005094709.1.79917 WP_005094709.1.80429 WP_005094709.1.9755 WP_005094709.1.98939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]