SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062SM41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062SM41
Domain Number 1 Region: 208-335
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 2.49e-43
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0000309
Further Details:      
 
Domain Number 2 Region: 9-196
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.18e-38
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A062SM41
Sequence length 344
Comment (tr|A0A062SM41|A0A062SM41_ACIBA) UDP-N-acetylmuramate dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00037} KW=Complete proteome OX=1310913 OS=Acinetobacter baumannii 25977_9. GN=J812_3570 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MQIQNQVQLKPFNTLSLDVTASHYTKITSVEDIKEALDFAKQHELNVLVLSGGSNMLLPQ
QINALVIHIDIQGIQVLSEDQDFVRVKVGAGQVWHDFVLCSTQQNWFGLQNLALIPGLVG
ASPVQNIGAYGVEVGEFIESVQVYDRKLGETQSILAADCHFSYRHSIFKDDPTRYIITHV
TFKLLKQPHLKLNYGDLKEAVGDNLTAENLQNQVIRIRQSKLPDPKEYPNVGSFFKNPIV
SAQEFERLITQFSTIPHYPQANGNVKIAAGWLIDQAGWKGKQLGVVGMFHKQALVLVNYA
NASLGDVKKTYQAVQHDVDQRFHVMLEPEPVLYNSLGLIENHTE
Download sequence
Identical sequences A0A014C0N8 A0A014C2L1 A0A014C6W0 A0A014CHA5 A0A014D3V9 A0A014DJS3 A0A014DLT8 A0A014DMP3 A0A062KSA8 A0A062MPP8 A0A062SM41
WP_017393383.1.100576 WP_017393383.1.16924 WP_017393383.1.17678 WP_017393383.1.21600 WP_017393383.1.21774 WP_017393383.1.29521 WP_017393383.1.31793 WP_017393383.1.370 WP_017393383.1.53546 WP_017393383.1.53558 WP_017393383.1.70478 WP_017393383.1.74078 WP_017393383.1.79917 WP_017393383.1.80429 WP_017393383.1.92445 WP_017393383.1.9755 WP_017393383.1.98939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]